LL-37 (CAP-18) 5mg available through SwissChems EU is a premium industrial-grade peptide formulated strictly for laboratory research applications. As the only naturally occurring human cathelicidin-derived antimicrobial peptide, LL-37 has drawn substantial interest within academic and biochemical research communities. Investigators frequently study its complex structural characteristics, mechanisms of action, and interactions within in vitro models. This comprehensive product overview details the molecular properties, scientific background, and analytical verification standards associated with this specialized research material, ensuring laboratories are equipped with accurate technical documentation.
Scientific Background and Peptide Classification
Cathelicidins represent a family of multifunctional host defense peptides found in various vertebrate species, with LL-37 serving as the sole member expressed in humans. Derived from the C-terminal region of human cationic antimicrobial protein 18 (hCAP-18), LL-37 is classified structurally as an amphipathic, alpha-helical peptide. Researchers investigate its broad-spectrum biochemical properties, noting its ability to interact dynamically with lipid membranes, cellular receptors, and various biological macromolecules. Understanding these fundamental mechanisms provides valuable insights into innate immunology and biochemical signaling pathways.
Molecular Characteristics and Sequence Composition
The molecular architecture of LL-37 is defined by its specific amino acid composition, consisting of 37 amino acid residues starting with two leucine residues, which inspired its designation. Documented analytical evaluations confirm its precise molecular weight and chemical formula, allowing researchers to maintain high reproducibility in experimental settings. The amphipathic nature of the peptide means that hydrophobic and hydrophilic residues are segregated on opposite faces of the alpha-helix, a structural trait crucial for its biochemical behavior in controlled laboratory assays.
Laboratory Testing and Analytical Verification
Maintaining strict quality control standards is paramount for reliable scientific research. SwissChems EU provides analytical testing documentation, such as High-Performance Liquid Chromatography (HPLC) and Mass Spectrometry (LC-MS) reports, to verify the identity, structural integrity, and purity of the LL-37 peptide supplied. These rigorous analytical methods ensure that researchers receive material that meets stringent laboratory specifications, minimizing experimental variables caused by degradation or synthesis impurities.
Research Applications and Methodological Limitations
Current scientific literature investigates LL-37 primarily in cell culture models, structural biology assays, and membrane interaction studies. Researchers explore its role in modulating inflammatory responses, wound healing pathways, and interactions with microbial surfaces in controlled environments. However, it is critical to acknowledge the limitations of existing evidence. Most data originate from in vitro or animal models, and translating these findings to complex biological systems requires cautious, methodical scientific inquiry. SwissChems EU supplies this peptide exclusively as an investigative tool, and it is not authorized or formulated for human consumption, clinical diagnosis, or therapeutic administration.
Regulatory Considerations and Safety Parameters
Handling investigational peptides requires strict adherence to institutional safety protocols and applicable European and international regulatory frameworks. LL-37 is intended strictly for qualified laboratory personnel operating within certified research facilities. Investigators must consult local chemical safety guidelines, utilize appropriate personal protective equipment, and adhere to recommended storage conditions—typically maintaining lyophilized material at low temperatures to ensure long-term stability. As scientific understanding of host defense peptides continues to evolve, transparent documentation and rigorous analytical standards remain foundational to advancing biochemical research responsibly.
Advancing our understanding of host defense mechanisms relies heavily on the precision and reproducibility of laboratory reagents. By providing rigorously tested research materials accompanied by transparent analytical documentation, SwissChems EU supports the academic and scientific communities in their ongoing exploration of complex peptide structures and their multifaceted biochemical roles.
Product Information Table
| Field | Required Information |
|---|---|
| Brand | SwissChems EU |
| Product Name | LL-37 (CAP-18) 5mg |
| Product Category | Industrial Grade Research Peptide |
| Composition | Cathelicidin-derived antimicrobial peptide |
| Amino Acid Sequence | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Molecular Formula | Not provided |
| Molecular Weight | 4493.3 g/mol (approximate, batch-dependent) |
| Purity | Verified via HPLC and LC-MS analysis |
| Concentration / Quantity | 5mg lyophilized powder |
| Analytical Testing | HPLC, LC-MS |
| Certificate of Analysis | Available per batch reference |
| Package Contents | 1 vial of LL-37 (CAP-18) 5mg |
| Country of Origin | Not provided |
| Shelf Life | Manufacturer-supported information available upon request |
| Storage Conditions | Store at -20°C as lyophilized powder |
| Manufacturing Standards | Documented laboratory standards |
| Licensing / Certification | Verified credentials for research supply |
| Safety Information | For laboratory research use only; not for human or veterinary use |
| Regulatory Status | Investigational research material |
Frequently Asked Questions
What is LL-37 (CAP-18)?
LL-37 is the only member of the cathelicidin family of antimicrobial peptides expressed in humans, derived from the hCAP-18 precursor protein.
What is the amino acid sequence of this peptide?
The documented sequence is LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES.
What do current scientific studies investigate regarding LL-37?
Research focuses on its membrane interactions, immunomodulatory properties, and behavior in various in vitro models.
How is peptide identity and purity assessed?
Identity and purity are evaluated using analytical methods such as High-Performance Liquid Chromatography and Mass Spectrometry.
What information does the Certificate of Analysis provide?
The Certificate of Analysis details batch-specific analytical results verifying the structural identity and purity of the peptide.
Are there limitations to current research?
Yes, most existing data are derived from in vitro assays, and findings cannot be directly extrapolated to human clinical applications.
What regulatory status applies to this product?
LL-37 is strictly classified as an investigational research material and is not approved for human consumption or therapeutic use.
Image filename: ll-37-peptide-vial-swisschems-eu.jpg
Product image alt text: LL-37 CAP-18 5mg research peptide vial from SwissChems EU on a laboratory bench.